PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000217510
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 292aa    MW: 33473.8 Da    PI: 8.7999
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000217510genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.66.8e-096397134
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkg 34
                     +g+W++eE+  l+ ++k++G+g +W t ++++g++
    MDP0000217510 63 KGPWSPEEEATLKAYIKKHGTGgNWITLPQKIGLR 97
                     79******************************944 PP

2Myb_DNA-binding34.25.8e-1198139346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r+++eEd  +  +    G++ W+ Ia+ +  gRt++++k++w++
    MDP0000217510  98 RFSEEEDNNICSLYMSIGSR-WSIIAAQLL-GRTDNDIKNYWNT 139
                      89******************.********9.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-95597IPR009057Homeodomain-like
SuperFamilySSF466894.21E-1660137IPR009057Homeodomain-like
SMARTSM007173.5E-1362143IPR001005SANT/Myb domain
PfamPF002491.2E-66397IPR001005SANT/Myb domain
CDDcd001675.55E-865141No hitNo description
PROSITE profilePS5129414.46493145IPR017930Myb domain
PfamPF002499.3E-1098139IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-1698145IPR009057Homeodomain-like
SuperFamilySSF522001.96E-5164209IPR000157Toll/interleukin-1 receptor homology (TIR) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007165Biological Processsignal transduction
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MGATRRGGGG VVSSKSPTKN KLLDWEWEKD ERDRYGVLAG EDGAHVDILT AYFANLLSAN  60
VKKGPWSPEE EATLKAYIKK HGTGGNWITL PQKIGLRRFS EEEDNNICSL YMSIGSRWSI  120
IAAQLLGRTD NDIKNYWNTR LKKKLLGKQH KQQEAQQSRR AXIFKKETRK TFTDLLYTAL  180
NNAGYLTFRD DDELKRGEDI KLGLQKIIAV LDCKSFSYMF DMELVEKKNV LVGDFMPSVK  240
FTDDLRTCAY LSTTDPNSKR FFFNNELHYV DPDPGHFFQA IREQIFGLQE PC
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.118861e-60bud| fruit| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008338133.11e-132PREDICTED: uncharacterized protein LOC103401186
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.11e-40myb domain protein 84